2024 Hopm interactor 7

Hopm interactor 7

Author: hzub

August undefined, 2024

WebConsolidated domain prediction view: G3DSA:1.10.1000.11 (Gene3D), a . Lotus Base uses cookies to allow user preferences to be stored. By continuing to browse the site you are agreeing to our use of cookies. WebGene ID: 110914954, updated on 28-Aug-2024 Summary Other designations brefeldin A-inhibited guanine nucleotide-exchange protein 5, putative HOPM interactor 7, putative …

Analysis of AtMIN7 knockout (KO) plants. (A) Growth of

WebPubMed tricycle aston

AceView: gene:ATMIN7, a comprehensive annotation of human, …

WebGene ID: At3g43300 Gene name: ATMIN7 (ARABIDOPSIS THALIANA HOPM INTERACTOR 7) Functional description: AtMIN7 is an immunity associated Arabidopsis … Web2 mrt. 2016 · 70. Interactor is a class which separates Domain Layer from Presentation Layer. In simple words it provides way to write business logic separately than code which is used for manipulate UI (by binding data to UI/ animate / navigation). So Interactor is mediator between Presenter/ViewModel and Repository pattern. Webdegradation of an Arabidopsis protein MIN7 (HopM interactor 7) that is required for cell wall-mediated defense (Nomura et al., 2006). Blocking the degradation of trans-Golgi … tricycle at target

The Magnaporthe oryzae Effector AvrPiz-t Targets the RING E3 …

WebDate Results Publications; 2024-02-20 13:35:00: Deciphering the Novel Role of AtMIN7 in Cuticle Formation and Defense against the Bacterial Pathogen Infection.: 32756392: … WebHOPM interactor 7 [Source:Projected from Arabidopsis thaliana (AT3G43300) TAIR;Acc:AT3G43300] Location. Chromosome 4: 30,004,775-30,015,241 forward strand. About this gene. This gene has 1 transcript (splice variant), 177 orthologues and 10 paralogues. Transcripts. Show transcript table Hide transcript table. Name terraria new items 1.4.4WebAncestor tree. A force layout showing the ancestor tree for GO:0032012, and its immediate children.If you wish to explore the tree dynamically, please use the GO Explorer.. Drag and drop nodes to manually position (i.e. fix) them tricycle assembly manual

"WebWelcome to our website! Call us at: 800-380-9586 Register Login Search Search Advanced Search All CategoriesProducts- Arabidopsis Antibodies- Algae Antibodies- Crop … " - Hopm interactor 7

Hopm interactor 7

Web13 jul. 2024 · HopM1 induces water soaking by targeting and degrading the water homeostasis-related protein Arabidopsis thaliana HopM interactor 7 (AtMIN7) (Nomura et al., 2006; Xin et al., 2016 ). Moreover, it was shown that AtMIN7-mediated immunity can limit the soaking-dependent pathogenesis of Pst ( Xin et al., 2016 ). WebID Position(s) Description; Region: 205-234: Disordered automatic annotation. BLAST Add. Sequence: VSPGSSVVKDMPSSITNDSENGEISTDGQD Region: 510-540: Disordered …

Did you know?

WebGene ID: 100383058, updated on 22-Aug-2024. Summary Other designations. Brefeldin A-inhibited guanine nucleotide-exchange protein 5, uncharacterized protein … WebGene Code Description / Information Gene name Correlation link; pcc 2.5% 97.5% PPI; 1: AT3G43300: HOPM interactor 7: HOPM interactor 7, BFA-VISUALIZED ENDOCYTIC …

WebMIN7: ARF GEF BEN1/HOPM Interactor 7 MT: microtubule MUNC18: SEC1-/mammalian uncoordinated-18 NAA: naphthalene-1-acetic acid NGS: Next-Generation Sequencing ... WebATMIN7 BEN1, BFA-VISUALIZED ENDOCYTIC TRAFFICKING DEFECTIVE1, HOPM interactor 7, AT3G43300 brefeldin A-inhibited guanine nucleotide-exchange protein 5 …

Webdegradation of an Arabidopsis protein MIN7 (HopM interactor 7) that is required for cell wall–mediated defense (Nomura et al., 2006). Blocking the degradation of trans-Golgi … http://www.khanglab.org/uploads/2/5/3/2/25329111/2012_park_et_al_avrpiz-t.pdf

Webatmin7 (arabidopsis thaliana hopm interactor 7) AtMIN7 is an immunity associated Arabidopsis protein targeted by HopM1, a conserved Pseudomonas syringae virulence …

WebName (RefSeq) HOPM interactor 7 KO K13462 guanine nucleotide-exchange factor Organism ath Arabidopsis thaliana (thale cress) Brite KEGG Orthology (KO) … tricycle a toulouseWeb6 feb. 2013 · Target of hopM1, a conserved Pseudomonas syringae virulence protein that directs the protein to its own proteasome-mediated degradation. Plays a broad role in … tricycle attachmentsWebHOPM interactor 7;(source:Araport11) TAIR Curator Summary: AtMIN7 is an immunity associated Arabidopsis protein targeted by HopM1, a conserved Pseudomonas syringae … tricycle at big lotshttp://webs2.kazusa.or.jp/kagiana/cgi-bin/subfunc.cgi?agi=At3g43300&name=ATMIN7%20(ARABIDOPSIS%20THALIANA%20HOPM%20INTERACTOR%207)&func=AtMIN7%20is%20an%20immunity%20associated%20Arabidopsis%20protein%20targeted%20by%20HopM1,%20a%20conserved%20Pseudomonas%20syringae%20virulence%20protein.%20%20AtMIN7%20encodes%20one%20of%20the%20eight%20members%20of%20the%20Arabidopsis%20adenosine%20diphosphate%20(ADP)%20ribosylation%20factor%20(ARF)%20guanine%20nucleotide%20exchange%20factor%20(GEF)%20protein%20family.%20%20The%20AFR%20GEF%20proteins%20are%20key%20components%20of%20the%20vesicle%20trafficking%20system%20in%20eukaryotic%20cells.%20%20HopM1%20mediates%20the%20destruction%20of%20AtMIN7%20via%20the%20host%20proteasome. tricycle at gameWebReceptor-like kinases and receptor-like proteins possess extracellular domains and are involved in the perception of conserved microbial features, called pathogen-or microbe-associated molecular patterns (PAMPs/MAMPs) or … tricycle baby driver confort smobyWebHOPM interactor 7 [Source:Projected from Arabidopsis thaliana (AT3G43300) TAIR;Acc:AT3G43300] Location. Chromosome 4: 30,004,775-30,015,241 forward … tricycle awakensWebAtMIN7 is an immunity associated Arabidopsis protein targeted by HopM1, a conserved Pseudomonas syringae virulence protein. AtMIN7 encodes one of the eight members of … terraria news on console